set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 70
let $p=Database_ID_11
res_secstru 0=C 2=E 5=C 11=E 14=C 16=E 19=C 29=H 31=C 40=H 47=C 51=H 60=C 66=E 67=C 73=H 87=C 92=H 102=C 106=H 120=C,$p
let $V1=icon $V1,$p
set_conservation_threshold 70
set_color_mode charge
set_characters_per_line 60
#----------
set_characters_per_line 60
set_conservation_threshold 70
set_color_mode charge
# The next line sets the secondary structure. H=helix, E=extended sheet
secondary_structure CCEEECCCCCCEEECCEEECCCCCCCCCCHHCCCCCCCCCHHHHHHHCCCCHHHHHHHHHCCCCCCECCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC,Database_ID_11
new_selection 1-4, Canus/N-terminus
set_annotation Hyperrefs=http://en.wikipedia.org/wiki/N-terminus, Canus/N-terminus
set_annotation Style=STYLE_BACKGROUND, Canus/N-terminus
set_annotation Color=#00ffFF, Canus/N-terminus
add_annotation Balloon=Balloon text blablabla, Canus/N-terminus
# Deleted commands: [aa_sequence ]
#end_of_script_1474850683916_
| ==> ==> ==> \/ /\/\/\/ \/\/\/\/\
|
| Database_ID_11 | MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLERLYPTAQSKRSLWDF |
| > \/\/\/\/\/\/\/ /\/\/\/\/\ /\/\/\/\/\/\/\
|
| ASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKCQQDDDRLLQIILNLLH |
|
|
| KV |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.