set_characters_per_line 60
set_color_mode charge
set_conservation_threshold 70
let $p=Database_ID_13
res_secstru 0=C 2=E 8=C 24=E 26=C 28=E 34=C 37=H 44=C 59=E 62=C 67=H 77=C 78=H 79=C 85=E 87=C 99=H 122=C 125=H 129=C 132=H 137=C 141=H 156=C 157=H 169=C 177=H 179=C 185=H 193=C 197=H 217=C,$p
let $V1=icon $V1,$p
set_conservation_threshold 70
set_color_mode charge
set_characters_per_line 60
#----------
set_characters_per_line 60
set_conservation_threshold 70
set_color_mode charge
# The next line sets the secondary structure. H=helix, E=extended sheet
secondary_structure CCEEEEEECCCCCCCCCCCCCCCCEECCEEEEEECCCHHHHHHHCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHCHCCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCCCCCHHCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCC,Database_ID_13
new_selection 1-4, Canus/N-terminus
set_annotation Hyperrefs=http://en.wikipedia.org/wiki/N-terminus, Canus/N-terminus
set_annotation Style=STYLE_BACKGROUND, Canus/N-terminus
set_annotation Color=#00ffFF, Canus/N-terminus
add_annotation Balloon=Balloon text blablabla, Canus/N-terminus
# Deleted commands: [aa_sequence ]
#end_of_script_1474850687163_
| =====> => =====> \/\/\/\ =
|
| Database_ID_13 | MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQKSEQYANNLAGRTESPQGSSLASRIT |
| => \/\/\/\/\/ / => \/\/\/\/\/\/\/\/\/\/\
|
| EKLSSMAHSAIEFIKRMFSEGSHKPVVTPAPTPAQMPSPTSFSDSIKQLAAETLPKYMQQ |
| /\ \/\/ /\/\/ \/\/\/\/\/\/\/\ \/\/\/\/\/\/ \/
|
| LSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQ |
| \/\/\/\/ \/\/\/\/\/\/\/\/\/\/
|
| WGTIGGAASAYVASGVDLTQAANELKGLAQQMHQLLSLM |
If you see this text, then Java-Script did not work
Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer
License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.